Gene AT1G56210.1


Sequence ID AT1G56210.1  add to my list
Species Arabidopsis thaliana
Alias Q9C7J6
Length 364aa
PubMed References
Open Display PubMed Reference(s) (5)
Accession Description
Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.
11130712 		Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.
Empirical analysis of transcriptional activity in the Arabidopsis genome.
14593172 		Empirical analysis of transcriptional activity in the Arabidopsis genome.
Metallochaperone-like genes in Arabidopsis thaliana.
21072340 		Metallochaperone-like genes in Arabidopsis thaliana.
Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
27862469 		Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
Heavy metal-associated isoprenylated plant protein (HIPP): characterization of a family of proteins exclusive to plants.
23368984 		Heavy metal-associated isoprenylated plant protein (HIPP): characterization of a family of proteins exclusive to plants.
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 364 amino acids

>AT1G56210.1_ARATH
MATDEMKSETKKTEHKQKQSTQIKQDLPPPTIPPLPLPYKSCTLKVSIHCEGCKRKVKKI
LTSIEGVFKVDIDVKQHKVTVIGIISPEILLKKLNKAGKNAEQLPEIPDPVDNKPKPVDP
KEKNKKKKKEEKVQITNEATSSGIDNPEKPGSGECDKPESEKPVDEKCLSGDGGETSGPV
KEEKKDVLKEKDSGKEESPSPPADSSAPAAEKKAEDTGGAVPDNGKVGKKKKKKGQSLAT
TNNPTDGPARTQSLPPPTATDYDRPINQINDHHITTTNNPPRHDLYPYPAQGYYAPQVMY
GVSYNVAQPPVSVDAASYYTPPPPYSYAYMHNGYQPSDQNPCQPRPSDSFELFSDENPNG
CAIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP023608 Unannotated cluster
3 GP040483 Unannotated cluster
4 GP070015 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for AT1G56210.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Ca_18_40.10 orthology 1 4 - -
Ca_31_336.3 orthology 1 4 - -
Cc02_g33120 orthology 0.993 4 96.3 3.06e-22
brana_pan_p003618 orthology 0.289 2 376 5.17e-130
brana_pan_p018109 orthology 0.288 2 - -
braol_pan_p013743 orthology 0.288 2 370 1.77e-127
brarr_pan_p006678 orthology 0.296 2 374 4.02e-129
maize_pan_p033245 orthology 1 3 - -