Gene AT1G71050.1


Sequence ID AT1G71050.1  add to my list
Species Arabidopsis thaliana
Alias Q9C9A3
Length 152aa
PubMed References
Open Display PubMed Reference(s) (7)
Accession Description
Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.
11130712 		Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.
Empirical analysis of transcriptional activity in the Arabidopsis genome.
14593172 		Empirical analysis of transcriptional activity in the Arabidopsis genome.
Functional annotation of a full-length Arabidopsis cDNA collection.
11910074 		Functional annotation of a full-length Arabidopsis cDNA collection.
Stress induced and nuclear localized HIPP26 from Arabidopsis thaliana interacts via its heavy metal associated domain with the drought stress related zinc finger transcription factor ATHB29.
18974936 		Stress induced and nuclear localized HIPP26 from Arabidopsis thaliana interacts via its heavy metal associated domain with the drought stress related zinc finger transcription factor ATHB29.
Metallochaperone-like genes in Arabidopsis thaliana.
21072340 		Metallochaperone-like genes in Arabidopsis thaliana.
Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
27862469 		Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
Heavy metal-associated isoprenylated plant protein (HIPP): characterization of a family of proteins exclusive to plants.
23368984 		Heavy metal-associated isoprenylated plant protein (HIPP): characterization of a family of proteins exclusive to plants.
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 152 amino acids

>AT1G71050.1_ARATH
MGALDSLSEYISDYFRVTRKRRKRKVMQTVNIKVKMDCDGCERRVKNAVSSMKGVKSVEV
NRKIHKVTVSGYVEPKKVLKRIERTGKKAEIWPYVPYNMVAYPYAVGTYDKKAPAGYVRK
SEQSQLQLLPGAPENHYISLFSDENPNACTVM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463678 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for AT1G71050.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
brana_pan_p002075 orthology 0.127 2 267 2.57e-93
braol_pan_p030499 orthology 0.127 2 267 2.33e-93
brarr_pan_p031034 orthology 0.127 2 267 2.08e-93