Gene AT2G17500.1


Sequence ID AT2G17500.1  add to my list
Species Arabidopsis thaliana
Alias Q9SHL8
Length 396aa
PubMed References
Open Display PubMed Reference(s) (5)
Accession Description
Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana.
10617197 		Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana.
Analysis of multiple occurrences of alternative splicing events in Arabidopsis thaliana using novel sequenced full-length cDNAs.
19423640 		Analysis of multiple occurrences of alternative splicing events in Arabidopsis thaliana using novel sequenced full-length cDNAs.
Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
27862469 		Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
A novel putative auxin carrier family regulates intracellular auxin homeostasis in plants.
22504182 		A novel putative auxin carrier family regulates intracellular auxin homeostasis in plants.
Evolution and structural diversification of PILS putative auxin carriers in plants.
23091477 		Evolution and structural diversification of PILS putative auxin carriers in plants.



Length: 396 amino acids

>AT2G17500.1_ARATH
MGFWSLLEVASMPVIQVLFMSLVGAFMASDRCKLFPVEARNSMNKVVFVLFAPALMFANL
AQTVTLEDIISWWFMPVNMGLTFLIGGLLGWLVVKILKPPPYLEGLIVATCSAGNMGNLP
IILVPAICDEDKSPFGNRSVCRTVGLSYASFSMALGGFYIWTYTFRLIKGSAMKVQAIEE
SEKIAIKSSNSDLEADHKTHLLGAPEDKENKVVKEKTGFWRKGVDFLHEILEELLAPPTL
GAIIGFIFGAVRWLRNLIIGDDAPLRIVQSTAKLLGDGTIPCMTIILGGNLIQGLRSSAV
KPMVVLGIVCVRYIAMPIIGIGIVLTAANLGFLPADPLFQYVLMLQFTLPPAMNIGTMTQ
LYNVAQDECSVLMLWTYLVAILALTVWSTIFLHLLV




Clustering Level Family ID Family Name
1
Auxin efflux carrier family
GP000355		 Auxin efflux carrier family
2 GP015273 Unannotated cluster
3 GP040583 Unannotated cluster
4 GP463648 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Membrane transport protein
IPR004776 		Membrane transport protein Family

IPR004776
Figure 1: IPR domains for AT2G17500.1