Gene AT3G02960.1
Sequence ID | AT3G02960.1 add to my list | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|
Species | Arabidopsis thaliana | ||||||||||
Alias | Q9M8T7 | ||||||||||
Length | 246aa | ||||||||||
PubMed References |
Display PubMed Reference(s) (4)
|
||||||||||
Gene Ontology |
Display term(s) (1)
|
Length: 246 amino acids
>AT3G02960.1_ARATH MGKNKQNGESDNKSEKKNQKNGDSSVDKSDKKNQCKEIVLKVYMHCEGCASQVSHCLRGY DGVEHIKTEIGDNKVVVSGKFDDPLKILRRVQKKFSRNAEMISPKHNPKQDQKEPQQKKE SAPEIKTAILRMNMHCEGCVHEIKRGIEKIKGIQSVEPDRSKSTVVVRGVMDPPKLVEKI KKKLGKHAELLSQITEKGKDNNKKNNNKKEESDGNKIFSYPPQYSSQHAYPSQIFSDENV HSCSIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for AT3G02960.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Cg7g016680.1 | orthology | 1 | 6 | 162.9 | 2.4e-40 |
Cm174370.1 | orthology | 1 | 5 | 176.8 | 2.7e-44 |
Cs7g11080.1 | orthology | 1 | 6 | 186 | 2.9e-47 |
Manes.13G008700.1 | orthology | 0.942 | 4 | 212.2 | 4.1e-55 |
brana_pan_p048220 | orthology | 0.169 | 2 | 354 | 3e-124 |
braol_pan_p002896 | orthology | 0.162 | 2 | 349 | 1.77e-122 |
brarr_pan_p015545 | orthology | 0.158 | 1 | 353 | 5.26e-124 |
orange1.1t05450.1 | orthology | 1 | 6 | - | - |
thecc_pan_p009145 | orthology | 0.875 | 3 | 226 | 1.83e-74 |
thecc_pan_p020513 | orthology | 1 | 3 | - | - |