Gene AT3G56240.1


Sequence ID AT3G56240.1  add to my list
Species Arabidopsis thaliana
Alias O82089, A0A178V898
Length 121aa
PubMed References
Open Display PubMed Reference(s) (9)
Accession Description
Empirical analysis of transcriptional activity in the Arabidopsis genome.
14593172
Empirical analysis of transcriptional activity in the Arabidopsis genome.
Sequence and analysis of chromosome 3 of the plant Arabidopsis thaliana.
11130713
Sequence and analysis of chromosome 3 of the plant Arabidopsis thaliana.
Copper chaperone antioxidant protein1 is essential for copper homeostasis.
22555879
Copper chaperone antioxidant protein1 is essential for copper homeostasis.
Identification of a functional homolog of the yeast copper homeostasis gene ATX1 from Arabidopsis.
9701579
Identification of a functional homolog of the yeast copper homeostasis gene ATX1 from Arabidopsis.
Functional and conformational properties of the exclusive C-domain from the Arabidopsis copper chaperone (CCH).
11439106
Functional and conformational properties of the exclusive C-domain from the Arabidopsis copper chaperone (CCH).
Evidence for the plant-specific intercellular transport of the Arabidopsis copper chaperone CCH.
11309142
Evidence for the plant-specific intercellular transport of the Arabidopsis copper chaperone CCH.
Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features.
22223895
Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features.
Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
27862469
Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
Chromosome-level assembly of Arabidopsis thaliana Ler reveals the extent of translocation and inversion polymorphisms.
27354520
Chromosome-level assembly of Arabidopsis thaliana Ler reveals the extent of translocation and inversion polymorphisms.
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 121 amino acids

>AT3G56240.1_ARATH
MAQTVVLKVGMSCQGCVGAVNRVLGKMEGVESFDIDIKEQKVTVKGNVEPEAVFQTVSKT
GKKTSYWPVEAEAEPKAEADPKVETVTETKTEAETKTEAKVDAKADVEPKAAEAETKPSQ
V





Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323
Heavy metal transport/detoxification protein superfamily
2 GP239638 Unannotated cluster
3 GP341755 Unannotated cluster
4 GP463817 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121
Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163
Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for AT3G56240.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
brana_pan_p026835 orthology 0.236 2 - -
brana_pan_p053758 orthology 0.231 2 - -
braol_pan_p031860 orthology 0.231 2 - -
brarr_pan_p007720 orthology 0.232 2 - -