Gene AT4G39700.1


Sequence ID AT4G39700.1  add to my list
Species Arabidopsis thaliana
Alias O65657
Length 158aa
PubMed References
Open Display PubMed Reference(s) (5)
Accession Description
Sequence and analysis of chromosome 4 of the plant Arabidopsis thaliana.
10617198 		Sequence and analysis of chromosome 4 of the plant Arabidopsis thaliana.
Stress induced and nuclear localized HIPP26 from Arabidopsis thaliana interacts via its heavy metal associated domain with the drought stress related zinc finger transcription factor ATHB29.
18974936 		Stress induced and nuclear localized HIPP26 from Arabidopsis thaliana interacts via its heavy metal associated domain with the drought stress related zinc finger transcription factor ATHB29.
Metallochaperone-like genes in Arabidopsis thaliana.
21072340 		Metallochaperone-like genes in Arabidopsis thaliana.
Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
27862469 		Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
Heavy metal-associated isoprenylated plant protein (HIPP): characterization of a family of proteins exclusive to plants.
23368984 		Heavy metal-associated isoprenylated plant protein (HIPP): characterization of a family of proteins exclusive to plants.
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 158 amino acids

>AT4G39700.1_ARATH
MGVGGTLEYISELIGNGGSHSYGKRKKKKQFQTVELKVRMDCDGCVLKIKNSLSSLKGVK
TVEINKKQQKVTVSGYADASKVLKKAKATGKKAEIWPYVPYNLVAQPYIAQAYDKKAPPG
YVRKVDPNVTTGTMAVYYDDPSYTSLFSDDNPNACSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463617 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for AT4G39700.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
AUR62002038-RA orthology 0.436 4 - -
AUR62003759-RA orthology 0.417 4 225.3 4.4e-59
Bv6_135550_hnzj.t1 orthology 0.428 4 229.6 1.3e-60
PGSC0003DMP400038108 orthology 0.367 3 231.9 3e-61
Solyc04g054500.2.1 orthology 0.336 3 233.4 1e-61
brana_pan_p027029 orthology 0.0591 3 304 9.94e-108
braol_pan_p025817 orthology 0.0649 2 300 3.02e-106
brarr_pan_p028146 orthology 0.0591 3 304 8.03e-108