Gene AT5G19090.1


Sequence ID AT5G19090.1  add to my list
Species Arabidopsis thaliana
Alias F4JZL7
Length 587aa
PubMed References
Open Display PubMed Reference(s) (5)
Accession Description
Empirical analysis of transcriptional activity in the Arabidopsis genome.
14593172 		Empirical analysis of transcriptional activity in the Arabidopsis genome.
Sequence and analysis of chromosome 5 of the plant Arabidopsis thaliana.
11130714 		Sequence and analysis of chromosome 5 of the plant Arabidopsis thaliana.
Metallochaperone-like genes in Arabidopsis thaliana.
21072340 		Metallochaperone-like genes in Arabidopsis thaliana.
Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
27862469 		Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
Heavy metal-associated isoprenylated plant protein (HIPP): characterization of a family of proteins exclusive to plants.
23368984 		Heavy metal-associated isoprenylated plant protein (HIPP): characterization of a family of proteins exclusive to plants.
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 587 amino acids

>AT5G19090.1_ARATH
MSKEEFMKIQTCVLKVNIHCDGCKQKVKKILQKIEGVFTTKIDAELGKVTVSGNVDPSVL
IKKLLKSGKHAEIWGAPKGGSNNNQNQPNLANQFKAMQIDHGGKGGGGGGGGPANNNKGQ
KIGGGGGGGGGGGGGGGGGPPKMVIPQLTPQQMQQLNPQQLQQLQQLQQMKGFQDLKLPP
QLKGGPGPGPGSVPMNKNPQMPNNPNQKAVKFNVPDDDDEEDFSDEFDDEFDEDDDEFDD
DLEDDEFDDHPPPPNKMKPMMGGGNMIMPNNMMPNMMMPNAQQMLNAHKNGGGPGPAGGK
IEGKGMPFPVQMGGGGGGPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGG
GGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGGGGPMSGGLPPGFRPMGGGGGGGGGPQ
SMSMPMGGAMGGPMGSLPQMGGGPGPMSNNMQAVQGLPAMGPGGGGGGGPSAEAPPGYFQ
GQVSGNGGGGQDSMPGNPYLQQQQQQQQQQYLAAVMNQQRSMGNERFQPMMYARPPPAVN
YMPPQPQPHQQHPYPYPYPYPPQYPPHNGDQYSDYFNDENTSSCNIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP023608 Unannotated cluster
3 GP040483 Unannotated cluster
4 GP070015 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for AT5G19090.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
MELO3C021404.2.1 orthology 0.539 3 164.1 2.3e-40
brana_pan_p035280 orthology 0.101 2 - -
brana_pan_p037105 orthology 0.116 2 363 8.65e-119
brana_pan_p042083 orthology 0.116 2 - -
brana_pan_p072847 orthology 0.116 2 - -
braol_pan_p001592 orthology 0.116 2 431 2.42e-144
braol_pan_p007803 orthology 0.109 2 - -
brarr_pan_p000054 orthology 0.114 2 450 8.06e-152
brarr_pan_p021889 orthology 0.104 2 - -
cucsa_pan_p012169 orthology 0.507 3 - -