Gene AT5G63530.1


Sequence ID AT5G63530.1  add to my list
Species Arabidopsis thaliana
Alias Q9C5D3
Length 355aa
PubMed References
Open Display PubMed Reference(s) (7)
Accession Description
Empirical analysis of transcriptional activity in the Arabidopsis genome.
14593172 		Empirical analysis of transcriptional activity in the Arabidopsis genome.
Structural analysis of Arabidopsis thaliana chromosome 5. III. Sequence features of the regions of 1,191,918 bp covered by seventeen physically assigned P1 clones.
9501997 		Structural analysis of Arabidopsis thaliana chromosome 5. III. Sequence features of the regions of 1,191,918 bp covered by seventeen physically assigned P1 clones.
Identification of cDNAs encoding isoprenylated proteins.
8837031 		Identification of cDNAs encoding isoprenylated proteins.
Metallochaperone-like genes in Arabidopsis thaliana.
21072340 		Metallochaperone-like genes in Arabidopsis thaliana.
Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
27862469 		Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
Heavy metal-associated isoprenylated plant protein (HIPP): characterization of a family of proteins exclusive to plants.
23368984 		Heavy metal-associated isoprenylated plant protein (HIPP): characterization of a family of proteins exclusive to plants.
A new class of proteins capable of binding transition metals.
10561075 		A new class of proteins capable of binding transition metals.
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 355 amino acids

>AT5G63530.1_ARATH
MGEEEKKPEAAEEKKMEEKKPEEKKEGEDKKVDAEKKGEDSDKKPQEGESNKDSKEDSAP
AAPEAPAPPPPPQEVVLKVYMHCEGCARKVRRCLKGFEGVEDVMTDCKTGKVVVKGEKAD
PLKVLARVQRKTHRQVQLLSPIPPPPPPPEKKAEEDKPIVEEKKVEPPVVVTVVLKVHMH
CEACATEIKKRIMRMKGVESAESDLKSSQVTVKGVFEPQKLVEYVYKRTGKHAAIMKIDP
PPPPPPEEAAAAAEGEKKEEEKGEGESKGEEGKDDKAKTDEEKKEGDGGKGEGEAADNGG
GEEEGKVVEVRKIENPYYYYYYQPPRVAIPPMEMPPHAYPPQLFSDENPNACTVM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015545		 Heavy metal transport/detoxification group1
3 GP040674 Unannotated cluster
4 GP070448 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for AT5G63530.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
brana_pan_p027602 orthology 0.124 3 - -
brana_pan_p044785 orthology 0.0977 2 327 4.63e-111
brana_pan_p064413 orthology 0.172 1 - -
brana_pan_p064539 orthology 0.0953 1 - -
brana_pan_p065969 orthology 0.0983 3 - -
braol_pan_p008881 orthology 0.103 1 345 1.07e-117
braol_pan_p013733 orthology 0.0959 2 - -
braol_pan_p031365 orthology 0.124 3 - -
brarr_pan_p006697 orthology 0.109 3 - -
brarr_pan_p014872 orthology 0.123 2 - -
brarr_pan_p028770 orthology 0.0967 2 302 3.9e-102