Gene AT5G66110.1
Sequence ID | AT5G66110.1 add to my list | ||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Species | Arabidopsis thaliana | ||||||||||||||
Alias | Q67ZW1 | ||||||||||||||
Length | 147aa | ||||||||||||||
PubMed References |
Display PubMed Reference(s) (6)
|
||||||||||||||
Gene Ontology |
Display term(s) (1)
|
Length: 147 amino acids
>AT5G66110.1_ARATH MGFRDICYRKHHKKLKQFQKVEIKVKMDCEGCERRVRKSVEGMKGVSKVTVDPKQSKLTV EGFVQPSKVVHRVMHRTGKKAELWPYVPYEVVPHPYAPGAYDKKAPPGYVRNALADPLVA PLARASSFEVKYTSAFSDDNPNACTIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for AT5G66110.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Cg1g001350.1 | orthology | 0.442 | 8 | 219.5 | 1.3e-57 |
Cm173610.1 | orthology | 0.436 | 7 | 229.9 | 1.6e-60 |
Cm280940.1 | orthology | 0.436 | 7 | 228 | 4.08e-78 |
Cs1g25820.1 | orthology | 0.436 | 8 | 224.6 | 4.3e-59 |
MELO3C007926.2.1 | orthology | 0.324 | 3 | 219.9 | 8.9e-58 |
Manes.01G148900.1 | orthology | 0.385 | 3 | 209.5 | 1.6e-54 |
brana_pan_p030902 | orthology | 0.0467 | 3 | 240 | 2.64e-83 |
braol_pan_p039277 | orthology | 0.0385 | 2 | 242 | 4.13e-84 |
brarr_pan_p021369 | orthology | 0.0467 | 3 | 240 | 2.13e-83 |
cucsa_pan_p018650 | orthology | 0.325 | 3 | 217 | 7.64e-74 |
maldo_pan_p003753 | orthology | 0.377 | 5 | 205 | 2.39e-69 |
medtr_pan_p005386 | orthology | 0.52 | 7 | 219 | 1.93e-74 |
thecc_pan_p011891 | orthology | 0.448 | 7 | 218 | 2.06e-74 |