Gene AUR62005083-RA
Sequence ID | AUR62005083-RA add to my list |
---|---|
Species | Chenopodium quinoa |
Alias | No gene alias |
Length | 218aa |
Length: 218 amino acids
>AUR62005083-RA_CHEQI MMAAPPKEQQQKAGKDGKGGKKEGGGMASMIKGMLGGGGGGNSEKKKGNDGKKDGKNGGN NNKGGGKNGEHGKNGGGGGKQGGGGLGKVGNFPMAQMGMGPAAAGLPATHMMMNGGGPAG GGGGGYYQGMGPGQGPSPAQFNSQQQQYMAMMMNQQRMNGGEGYGMMAPQAAQPMNMMYG RPPMGPMGYAPSMVPPPGYHDPYTSYFSDENTDSCSIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP023608 | Unannotated cluster |
3 | GP359920 | Unannotated cluster |
4 | GP492450 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
cocnu_pan_p030265 | orthology | 0.695 | 1 | - | - |
cocnu_pan_p031534 | orthology | 0.83 | 1 | - | - |