Gene AUR62005083-RA
| Sequence ID | AUR62005083-RA add to my list |
|---|---|
| Species | Chenopodium quinoa |
| Alias | No gene alias |
| Length | 218aa |
Length: 218 amino acids
>AUR62005083-RA_CHEQI MMAAPPKEQQQKAGKDGKGGKKEGGGMASMIKGMLGGGGGGNSEKKKGNDGKKDGKNGGN NNKGGGKNGEHGKNGGGGGKQGGGGLGKVGNFPMAQMGMGPAAAGLPATHMMMNGGGPAG GGGGGYYQGMGPGQGPSPAQFNSQQQQYMAMMMNQQRMNGGEGYGMMAPQAAQPMNMMYG RPPMGPMGYAPSMVPPPGYHDPYTSYFSDENTDSCSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP023608 | Unannotated cluster |
| 3 | GP359920 | Unannotated cluster |
| 4 | GP492450 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| cocnu_pan_p030265 | orthology | 0.695 | 1 | - | - |
| cocnu_pan_p031534 | orthology | 0.83 | 1 | - | - |