Gene AUR62010040-RA
| Sequence ID | AUR62010040-RA add to my list | ||
|---|---|---|---|
| Species | Chenopodium quinoa | ||
| Alias | No gene alias | ||
| Length | 155aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 155 amino acids
>AUR62010040-RA_CHEQI MGVMDHISDYFDCSGHGHRHHRKQLQTVEIKIKIDCEGCERKVRRAVEGMEGVNQVDIEP KLSKLTVVGYVEPRKVLARVKHRTGKRAEMWPYVPYDVVGHPYAAGTYDRKAPAGYVRSS EYNDPRTNQLSRMSSTEVRYTTAFSDENPAACSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for AUR62010040-RA
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AUR62013032-RA | ultra-paralogy | 0.0133 | 0 | - | - |
| Bv9_214040_ofct.t1 | orthology | 0.166 | 1 | - | - |