Gene AUR62037999-RA
Sequence ID | AUR62037999-RA add to my list | ||
---|---|---|---|
Species | Chenopodium quinoa | ||
Alias | No gene alias | ||
Length | 208aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 208 amino acids
>AUR62037999-RA_CHEQI MPSIEQAGVRAVDVNFEKSEVKVVGAFDSKKIHQKLERLSKRKVELLKVEQNYKHTVVVE KVVKETKEVAVFTHKVKVHLHCEQCEADLRRKLLRHKGIYNVKSDMKAQTLAVEGTIESE KLVKHIRSKFHKHAELITAKEIKKEEKKEKTEEIKKVEETKTTNKVIDVEEVKNVQEKLK ASNTPYIIHYVYAPQWFSDEDPNACSIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP342504 | Unannotated cluster |
4 | GP464372 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for AUR62037999-RA
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AUR62023334-RA | ultra-paralogy | 0.06 | 0 | - | - |
Bv1_016920_ytts.t1 | orthology | 0.212 | 1 | - | - |
vitvi_pan_p029858 | orthology | 0.811 | 2 | - | - |