Gene Bv5_110870_wcqq.t2


Sequence ID Bv5_110870_wcqq.t2  add to my list
Species Beta vulgaris
Alias No gene alias
Length 90aa
Gene Annotation cDNAEvidence=85.7
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 90 amino acids

>Bv5_110870_wcqq.t2_BETVU
MILRIKIDCNGCYRKVKEALLNIRELESHIIEKRSSRVIVFGIFTPQDVAIKIRKKTNRR
VEILEIQQLSPNYPENYQDQGYLMIATNDK




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP109350 Unannotated cluster
3 GP119142 Unannotated cluster
4 GP077996 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR036163
Figure 1: IPR domains for Bv5_110870_wcqq.t2



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Bv5_110870_wcqq.t1 ultra-paralogy 0.001 0 - -
CgUng002450.1 orthology 1 8 - -
Cm118330.1 orthology 1 7 - -
Cs7g26570.1 orthology 1 8 - -
FvH4_5g12320.1 orthology 1 7 - -
Manes.05G138100.1 orthology 0.879 6 - -
PGSC0003DMP400010112 orthology 1 8 - -
Solyc03g119630.2.1 orthology 1 9 - -
cajca.ICPL87119.gnm1.ann1.C.cajan_35493.1 orthology 1 7 108 2.15e-32
capan_pan_p000343 orthology 1 9 - -
cicar_pan_p024669 orthology 1 8 112 4.19e-34
cucsa_pan_p010693 orthology 0.614 1 - -
maldo_pan_p026714 orthology 1 7 111 2.97e-33
medtr_pan_p036900 orthology 1 8 - -
phavu.G19833.gnm2.ann1.Phvul.004G158700.1 orthology 1 7 - -
soybn_pan_p040036 orthology 1 7 - -
soybn_pan_p040183 orthology 1 7 - -
soybn_pan_p040952 orthology 1 7 - -
soybn_pan_p042566 orthology 1 7 - -
thecc_pan_p001600 orthology 0.729 2 - -
vitvi_pan_p014384 orthology 0.739 3 - -