Gene Bv5_110870_wcqq.t2
Sequence ID | Bv5_110870_wcqq.t2 add to my list | ||
---|---|---|---|
Species | Beta vulgaris | ||
Alias | No gene alias | ||
Length | 90aa | ||
Gene Annotation | cDNAEvidence=85.7 | ||
Gene Ontology |
Display term(s) (1)
|
Length: 90 amino acids
>Bv5_110870_wcqq.t2_BETVU MILRIKIDCNGCYRKVKEALLNIRELESHIIEKRSSRVIVFGIFTPQDVAIKIRKKTNRR VEILEIQQLSPNYPENYQDQGYLMIATNDK
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP109350 | Unannotated cluster |
3 | GP119142 | Unannotated cluster |
4 | GP077996 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Bv5_110870_wcqq.t2
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Bv5_110870_wcqq.t1 | ultra-paralogy | 0.001 | 0 | - | - |
CgUng002450.1 | orthology | 1 | 8 | - | - |
Cm118330.1 | orthology | 1 | 7 | - | - |
Cs7g26570.1 | orthology | 1 | 8 | - | - |
FvH4_5g12320.1 | orthology | 1 | 7 | - | - |
Manes.05G138100.1 | orthology | 0.879 | 6 | - | - |
PGSC0003DMP400010112 | orthology | 1 | 8 | - | - |
Solyc03g119630.2.1 | orthology | 1 | 9 | - | - |
cajca.ICPL87119.gnm1.ann1.C.cajan_35493.1 | orthology | 1 | 7 | 108 | 2.15e-32 |
capan_pan_p000343 | orthology | 1 | 9 | - | - |
cicar_pan_p024669 | orthology | 1 | 8 | 112 | 4.19e-34 |
cucsa_pan_p010693 | orthology | 0.614 | 1 | - | - |
maldo_pan_p026714 | orthology | 1 | 7 | 111 | 2.97e-33 |
medtr_pan_p036900 | orthology | 1 | 8 | - | - |
phavu.G19833.gnm2.ann1.Phvul.004G158700.1 | orthology | 1 | 7 | - | - |
soybn_pan_p040036 | orthology | 1 | 7 | - | - |
soybn_pan_p040183 | orthology | 1 | 7 | - | - |
soybn_pan_p040952 | orthology | 1 | 7 | - | - |
soybn_pan_p042566 | orthology | 1 | 7 | - | - |
thecc_pan_p001600 | orthology | 0.729 | 2 | - | - |
vitvi_pan_p014384 | orthology | 0.739 | 3 | - | - |