Gene Bv6_142170_makm.t1
| Sequence ID | Bv6_142170_makm.t1 add to my list |
|---|---|
| Species | Beta vulgaris |
| Alias | No gene alias |
| Length | 139aa |
| Gene Annotation | cDNAEvidence=100 |
Length: 139 amino acids
>Bv6_142170_makm.t1_BETVU MGVDVDYISKKEKIKDLGSVVPTQTSLAFMESLTMPHVQEVVISADVRCTECQKRIVDII SRFNEVETHVIERQYNRVSVCGRFRPSDVAIKIRRRMNRRVEILEIQEFDDGGGPPEQQQ QQPPVDNQPPIANGHAHIA
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP109350 | Unannotated cluster |
| 3 | GP119142 | Unannotated cluster |
| 4 | GP077996 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| sorbi_pan_p014632 | orthology | 1 | 1 | - | - |
| thecc_pan_p012357 | orthology | 0.891 | 2 | 102 | 1.17e-27 |
| thecc_pan_p021026 | orthology | 0.832 | 2 | - | - |