Gene Bv8_190260_chqz.t1
Sequence ID | Bv8_190260_chqz.t1 add to my list | ||
---|---|---|---|
Species | Beta vulgaris | ||
Alias | No gene alias | ||
Length | 157aa | ||
Gene Annotation | cDNAEvidence=100 | ||
Gene Ontology |
Display term(s) (1)
|
Length: 157 amino acids
>Bv8_190260_chqz.t1_BETVU MCRSPASTAVACMPDGMRSVVVPGKAHGRAMVVNQKGGIGRNSIKYSRLVESDDRLLKGN LKGDQGLPVSHNLLKKQRSLQLSSSDSTDMFQVVVLRVSLHCQACAGKVKKHLSRMEGVT SFSIDLDTKKVTIRGQVSPTVVLESVSKIKKAEFWTC
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP015837 | Unannotated cluster |
3 | GP040905 | Unannotated cluster |
4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Bv8_190260_chqz.t1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
PGSC0003DMP400022303 | orthology | 0.784 | 3 | 115.5 | 3.1e-26 |
Solyc01g105000.2.1 | orthology | 0.799 | 2 | 116.7 | 1.4e-26 |
capan_pan_p019823 | orthology | 0.83 | 3 | 116 | 1.2e-33 |
capan_pan_p036114 | orthology | 0.955 | 3 | - | - |
capan_pan_p041384 | orthology | 0.946 | 3 | - | - |
evm_27.model.AmTr_v1.0_scaffold00010.206 | orthology | 0.837 | 2 | 124 | 6.2e-29 |