Gene Ca_11_19.17
| Sequence ID | Ca_11_19.17 add to my list |
|---|---|
| Species | Coffea arabica |
| Alias | No gene alias |
| Length | 145aa |
Length: 145 amino acids
>Ca_11_19.17_COFAR MEILGSIVGVYSVAIDGEEGLAKIYGEVDPNMLLRAIGTSGRHAELVRMDIKHPQINEDA SCRRRHGYNYDALLENNPCGGGYGHGYGRSLPDHTSCYGHEQYYPNSYSHTAGGGALPQP RHVPSYPRRGYDPYDDERINCCSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP249079 | Unannotated cluster |
| 3 | GP354871 | Unannotated cluster |
| 4 | GP483173 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_13_370.9 | ultra-paralogy | 1 | 0 | - | - |
| Ca_16_23.17 | ultra-paralogy | 1 | 0 | - | - |