Gene Ca_14_162.1
| Sequence ID | Ca_14_162.1 add to my list | ||
|---|---|---|---|
| Species | Coffea arabica | ||
| Alias | No gene alias | ||
| Length | 274aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 274 amino acids
>Ca_14_162.1_COFAR MGEEKKEEANKEEQQKQVPGSKEDTSKKEEEGDKKEEKKEEEVQEIVLKVDMHCEACARK VTRALKGFQGVESVTADCKGSKVVVKGKSADPVKVCERIHRKSGRKVELISPLPKPLEEA PKAPVEEKKTEEPPAVITVVLNVQMHCEACAQVLQKRIRKVQGVESVTTDVANNQVVVKG VVDPEKLVTDVYKRTRKQASIVKDEAKKEDEKKDDVKTEVKENEKKESEEGKEGDDVKTD AKKSEYWPQRYYYMEYAYPSLMFSDENPHACTVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Ca_14_162.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_78_26.1 | orthology | 0 | 1 | - | - |
| Cg2g046420.1 | orthology | 0.589 | 9 | 185.7 | 3.8e-47 |
| Cm145580.1 | orthology | 0.806 | 8 | - | - |
| Cm298860.1 | orthology | 0.595 | 8 | - | - |
| Cs2g01750.1 | orthology | 0.589 | 9 | 196.1 | 3.1e-50 |
| DCAR_002239 | orthology | 0.465 | 5 | 204.9 | 7.2e-53 |
| DCAR_030843 | orthology | 0.508 | 5 | - | - |
| FvH4_3g00420.1 | orthology | 0.554 | 9 | 191.8 | 5.6e-49 |
| HanXRQChr16g0515801 | orthology | 0.609 | 5 | 160.6 | 2.2e-39 |
| MELO3C008010.2.1 | orthology | 0.696 | 8 | 185.3 | 4.5e-47 |
| Manes.09G082500.1 | orthology | 0.743 | 8 | - | - |
| Manes.S022000.1 | orthology | 0.516 | 8 | 168.3 | 7.6e-42 |
| Oeu029318.1 | orthology | 0.391 | 4 | 205.3 | 7.6e-53 |
| Oeu057024.1 | orthology | 0.429 | 4 | - | - |
| PGSC0003DMP400023518 | orthology | 0.671 | 5 | - | - |
| PGSC0003DMP400026383 | orthology | 0.436 | 4 | 205.3 | 5.2e-53 |
| Solyc04g015030.2.1 | orthology | 0.444 | 4 | 205.7 | 4e-53 |
| Solyc11g012690.1.1 | orthology | 0.72 | 5 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_16695.1 | orthology | 0.565 | 7 | 212 | 8.57e-69 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_24624.1 | orthology | 0.502 | 7 | 181.4 | 8.6e-46 |
| capan_pan_p012494 | orthology | 0.573 | 3 | - | - |
| capan_pan_p018045 | orthology | 0.686 | 4 | - | - |
| cicar_pan_p024449 | orthology | 0.522 | 6 | 229 | 3.51e-75 |
| cucsa_pan_p011686 | orthology | 0.685 | 8 | 214 | 1.24e-68 |
| ipotf_pan_p000797 | orthology | 0.458 | 4 | 232 | 5.71e-76 |
| itb01g10210.t2 | orthology | 0.464 | 4 | 198 | 9.1e-51 |
| maldo_pan_p012376 | orthology | 0.566 | 9 | - | - |
| maldo_pan_p020510 | orthology | 0.576 | 9 | 239 | 9.83e-79 |
| medtr_pan_p010658 | orthology | 0.507 | 6 | 223 | 1.28e-72 |
| phavu.G19833.gnm2.ann1.Phvul.003G086400.1 | orthology | 0.516 | 7 | 192.6 | 3.4e-49 |
| phavu.G19833.gnm2.ann1.Phvul.006G139700.1 | orthology | 0.553 | 7 | - | - |
| soybn_pan_p008938 | orthology | 0.496 | 6 | 232 | 5.81e-76 |
| soybn_pan_p009673 | orthology | 0.528 | 6 | - | - |
| soybn_pan_p024238 | orthology | 0.509 | 6 | - | - |
| thecc_pan_p018912 | orthology | 0.484 | 8 | 231 | 2.28e-75 |
| vitvi_pan_p012828 | orthology | 0.544 | 7 | 228 | 2.4e-74 |