Gene Ca_16_23.17
| Sequence ID | Ca_16_23.17 add to my list | ||
|---|---|---|---|
| Species | Coffea arabica | ||
| Alias | No gene alias | ||
| Length | 142aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 142 amino acids
>Ca_16_23.17_COFAR MRINIRCEACKMKAHEVFSSVVGVYSVRIDPNEGIACFYGEVEPAEFMSAITSFNNRHGR LVHANVKHPEINSDGSRNSGPGYSYGYPCYGYTYGRIHPTAAYPHRRVYRLHRPIGLIPP PTYMPELPRRHRKGSFKCFGMW
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP249079 | Unannotated cluster |
| 3 | GP354871 | Unannotated cluster |
| 4 | GP483173 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Ca_16_23.17
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_11_19.17 | ultra-paralogy | 1 | 0 | - | - |
| Ca_13_370.9 | ultra-paralogy | 0.001 | 0 | - | - |