Gene Ca_19_940.1
| Sequence ID | Ca_19_940.1 add to my list |
|---|---|
| Species | Coffea arabica |
| Alias | No gene alias |
| Length | 251aa |
Length: 251 amino acids
>Ca_19_940.1_COFAR MFKPLIDFKFCLYFILFWPSLLGIHELSIDPEKNLVLIRGNIDPFLLVKEIGRTGKPVEL IFYDKEPKIEEDKHQYHYERSGNCCKEKHPNHDDDHGNPKSWQNGREKHPNFCCRDDDLH PPKEDNNDEAHKDHEAPRKEKDDEEDIFKHPYFRFQRNASTNRGVPSWVGKQMFGNHADY QKQAHFDSYSSRYETWNPQCSRFFGGESASYDHYHSRMPQPPPPSYPYDFGDFENFTHYF NDYNTSGCIVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP241502 | Unannotated cluster |
| 3 | GP344090 | Unannotated cluster |
| 4 | GP467269 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| HanXRQChr09g0250511 | orthology | 1 | 2 | - | - |
| HanXRQChr16g0528781 | orthology | 1 | 2 | - | - |
| maize_pan_p014797 | orthology | 1 | 2 | - | - |
| maize_pan_p023480 | orthology | 1 | 2 | - | - |
| sorbi_pan_p012760 | orthology | 1 | 2 | - | - |
| sorbi_pan_p027660 | orthology | 1 | 2 | - | - |
| tritu_pan_p007910 | orthology | 1 | 1 | - | - |