Gene Ca_20_315.2
Sequence ID | Ca_20_315.2 add to my list | ||
---|---|---|---|
Species | Coffea arabica | ||
Alias | No gene alias | ||
Length | 130aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 130 amino acids
>Ca_20_315.2_COFAR MGALDYLSNFCTVTSTRRSKRKPMQTVEIKVKMDCDGCERRVKNAVKDMKVLTDLLDHSF ECNTRRSKLSSGCVSHVFLQASQIECIKKCSNMLGSFHKKKMRAKIDLDNYSTCGICEEC GTSCSSPKRN
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Ca_20_315.2
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
medtr_pan_p031324 | orthology | 1 | 2 | - | - |
musac_pan_p038219 | orthology | 1 | 2 | - | - |