Gene Ca_24_186.3
| Sequence ID | Ca_24_186.3 add to my list | ||
|---|---|---|---|
| Species | Coffea arabica | ||
| Alias | No gene alias | ||
| Length | 157aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 157 amino acids
>Ca_24_186.3_COFAR MRVHMDCPGCESKIKKALRKLDGVDNVDVDMGMQKVTVTGYADQEKVLKTVRKTGRLAEL WPFPYNPEYHDFNYAYYSHYYRNPATNFSVNPENYFASEATVFTKHDKYSFSSYNYEVHG YNGHDHGYYHKPPLSTVIDDRTRDMFSDENAHGCSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Ca_24_186.3
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cc02_g14880 | orthology | 0.023 | 1 | 230.7 | 5.7e-61 |
| Oeu043106.1 | orthology | 0.524 | 3 | - | - |
| PGSC0003DMP400018109 | orthology | 0.441 | 4 | - | - |
| Solyc02g076880.2.1 | orthology | 0.464 | 4 | - | - |
| capan_pan_p000797 | orthology | 0.449 | 3 | 189 | 1.12e-62 |
| ipotf_pan_p011098 | orthology | 0.453 | 5 | - | - |
| itb10g02670.t1 | orthology | 0.427 | 5 | 144.8 | 5.3e-35 |