Gene Ca_24_288.1
Sequence ID | Ca_24_288.1 add to my list |
---|---|
Species | Coffea arabica |
Alias | No gene alias |
Length | 170aa |
Length: 170 amino acids
>Ca_24_288.1_COFAR MAGVRTAETELSSGKVTVTGSMDANRLVEYVYRRTKKEAKVVPQPEPAPAEKPKEEALAK PSEGPIKEEKPPAAEGEEAKAPQVEKNPEEAAEKKGPQEEEVEEKKEGGGGESGNNGDAA GGNEAVMMMSNVDELSKQQMMYYYQPLYVMERIPPPQLFSDENPNACCIA
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP126431 | Unannotated cluster |
4 | GP077890 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Ca_88_414.1 | orthology | 0 | 1 | - | - |
Cc02_g00720 | orthology | 0.0158 | 2 | - | - |