Gene Ca_3_262.11
| Sequence ID | Ca_3_262.11 add to my list | ||
|---|---|---|---|
| Species | Coffea arabica | ||
| Alias | No gene alias | ||
| Length | 90aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 90 amino acids
>Ca_3_262.11_COFAR MKVEMAGIHEKRLRKCLSKLKGIEKVEVDGKSEKVTVTGYPHRNKILKAVRRGGLRADFW SPQNELLLLNAYASSAAAAPFPFNNFTSFF
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Ca_3_262.11
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_12_32.9 | orthology | 0 | 1 | - | - |
| Ca_455_136.3 | orthology | 0 | 1 | - | - |
| Cg3g025710.1 | orthology | 0.314 | 11 | - | - |
| Cm122260.1 | orthology | 0.326 | 10 | - | - |
| Cs3g27690.1 | orthology | 0.314 | 11 | - | - |
| DCAR_023025 | orthology | 0.281 | 4 | - | - |
| HORVU7Hr1G051110.3 | orthology | 1 | 11 | - | - |
| MELO3C017056.2.1 | orthology | 0.46 | 11 | - | - |
| Manes.05G127500.1 | orthology | 0.353 | 9 | - | - |
| Manes.18G002200.1 | orthology | 0.366 | 9 | - | - |
| Mba08_g25790.1 | orthology | 0.651 | 9 | - | - |
| ORGLA08G0178600.1 | orthology | 0.748 | 10 | - | - |
| Oeu013567.1 | orthology | 0.278 | 3 | - | - |
| Sspon.06G0001840-1A | orthology | 0.956 | 9 | - | - |
| Sspon.06G0001840-2C | orthology | 0.767 | 9 | - | - |
| Sspon.06G0001840-3D | orthology | 0.777 | 9 | - | - |
| XP_010932092.1 | orthology | 0.457 | 8 | - | - |
| XP_017697769.1 | orthology | 0.482 | 8 | - | - |
| XP_019707878.1 | orthology | 0.495 | 9 | - | - |
| bradi_pan_p007471 | orthology | 0.758 | 10 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_11445.1 | orthology | 0.469 | 7 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_22304.1 | orthology | 0.467 | 7 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_22894.1 | orthology | 0.465 | 6 | - | - |
| capan_pan_p037558 | orthology | 0.266 | 2 | - | - |
| cicar_pan_p012771 | orthology | 0.587 | 8 | - | - |
| cocnu_pan_p024788 | orthology | 0.457 | 8 | - | - |
| cocnu_pan_p029661 | orthology | 0.521 | 9 | - | - |
| cucsa_pan_p017207 | orthology | 0.46 | 11 | - | - |
| maize_pan_p023740 | orthology | 0.75 | 9 | - | - |
| maldo_pan_p020708 | orthology | 0.35 | 9 | - | - |
| medtr_pan_p031498 | orthology | 0.52 | 8 | - | - |
| musac_pan_p036492 | orthology | 0.639 | 9 | - | - |
| orysa_pan_p046260 | orthology | 0.723 | 10 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.002G208500.1 | orthology | 0.476 | 6 | - | - |
| sorbi_pan_p020199 | orthology | 0.726 | 9 | - | - |
| soybn_pan_p018879 | orthology | 0.519 | 6 | - | - |
| soybn_pan_p037728 | orthology | 0.544 | 7 | - | - |
| soybn_pan_p037999 | orthology | 0.586 | 7 | - | - |
| soybn_pan_p041984 | orthology | 0.554 | 7 | - | - |
| thecc_pan_p004256 | orthology | 0.362 | 10 | - | - |
| tritu_pan_p008810 | orthology | 0.763 | 11 | - | - |
| vitvi_pan_p014910 | orthology | 0.276 | 8 | - | - |
| vitvi_pan_p031077 | orthology | 0.276 | 8 | - | - |