Gene Ca_48_570.1


Sequence ID Ca_48_570.1  add to my list
Species Coffea arabica
Alias No gene alias
Length 141aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 141 amino acids

>Ca_48_570.1_COFAR
MDKRAPDPIIILKVDTNCCDDCSGKLEKALLEINGVNQAIVDPQKKSVSIRGNANSCMLI
EEIARMGKRAELMFYDKEPKVEGHHQKNVRFAQEKHPSTDDHHKQNVRQDDGHKHFCCDD
HDDGGEENMPSWGSKNIFGSH




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP241502 Unannotated cluster
3 GP344090 Unannotated cluster
4 GP467269 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Ca_48_570.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Ca_90_4.2 ultra-paralogy 0.0168 0 - -
HanXRQChr09g0250511 orthology 1 2 - -
HanXRQChr16g0528781 orthology 1 2 - -
maize_pan_p014797 orthology 1 2 - -
maize_pan_p023480 orthology 1 2 - -
sorbi_pan_p012760 orthology 1 2 - -
sorbi_pan_p027660 orthology 1 2 - -
tritu_pan_p007910 orthology 1 1 - -