Gene Ca_52_14.1


Sequence ID Ca_52_14.1  add to my list
Species Coffea arabica
Alias No gene alias
Length 353aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 353 amino acids

>Ca_52_14.1_COFAR
MGEKDEKKNEGEKKVTEAKNQGEKKAADGGGKKDDAQSPIVLKLDLHCEGCAKKVKRSIK
HFDGVEDVKADCASNKLTVTGNVDPGWLREKVEQRTKKKVELLSPPSKKESGGGGDKKAD
DKADKKSDDKKKDEPKKPKEPQVSAVVLKIRLHCDGCAHKIKRIIKKIDGVEEVAIDNEK
DLVTVKGTMDAKDLAPYLKDKLKRTVDVVPPKKDDGGGDKKAKEGGGDKKEKEKQKESGG
EKGAAESKGAGGGGGDKGKSIEEPKVEVHKLEYHGASASTPYTYYYGMPVYNQSYANQDY
GVSVPTMYNQGGYGTTGYVVDYRPHEPPPPPPVYLPTHDQMFSDENPNACSVM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015545		 Heavy metal transport/detoxification group1
3 GP040674 Unannotated cluster
4 GP071484 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Ca_52_14.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
DCAR_014996 orthology 0.63 4 - -
DCAR_017683 orthology 0.615 4 - -
HanXRQChr01g0027741 orthology 0.758 4 - -
HanXRQChr13g0401031 orthology 0.821 4 - -
HanXRQChr14g0454431 orthology 0.697 4 - -
HanXRQChr17g0570331 orthology 0.684 4 - -
Oeu005022.1 orthology 0.591 1 - -
Oeu016984.1 orthology 0.564 1 - -
Oeu019283.1 orthology 0.525 1 - -
Oeu045227.1 orthology 0.656 1 - -
Oeu061953.1 orthology 0.59 1 - -
PGSC0003DMP400006915 orthology 0.504 5 236.9 2.1e-62
Solyc09g008200.2.1 orthology 0.543 5 232.6 3.9e-61
Solyc10g086280.1.1 orthology 0.685 4 - -
capan_pan_p000093 orthology 0.81 4 - -
capan_pan_p021581 orthology 0.564 4 - -
ipotf_pan_p002813 orthology 0.657 4 - -
ipotf_pan_p014346 orthology 0.585 4 - -
itb06g04100.t1 orthology 0.577 4 - -
itb15g00310.t1 orthology 0.661 4 - -