Gene Ca_63_12.7
| Sequence ID | Ca_63_12.7 add to my list |
|---|---|
| Species | Coffea arabica |
| Alias | No gene alias |
| Length | 133aa |
Length: 133 amino acids
>Ca_63_12.7_COFAR MYIYVVAGVYTVEVDAREGLAKVYGEVDPNILLMALSRSGKHAEVAWVRLKHPALSNDCH NSGCHGRYTGRGPSWYDQNGYCHLGQQPFCPRRRAMADHQDPYQRHHGCGGYGYGPYAYP PGADDTAPYCSVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP241299 | Unannotated cluster |
| 3 | GP344409 | Unannotated cluster |
| 4 | GP469723 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Figure 1: IPR domains for Ca_63_12.7
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_9_94.4 | ultra-paralogy | 0.001 | 0 | - | - |