Gene Ca_68_16.11
| Sequence ID | Ca_68_16.11 add to my list | ||
|---|---|---|---|
| Species | Coffea arabica | ||
| Alias | No gene alias | ||
| Length | 95aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 95 amino acids
>Ca_68_16.11_COFAR METVEMKVEMAGIHEKRLRKCLSKLKGIEKVEVDGKSEKVTVTGCPHRNKILKAVRRGGL RADFWSPQNELLLLNAYASSAAAAPFPFNNFTFFF
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Ca_68_16.11
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cc10_g00290 | orthology | 0.0011 | 1 | 176.8 | 5.9e-45 |
| Cg3g025710.1 | orthology | 0.337 | 11 | 131.7 | 2.3e-31 |
| Cm122260.1 | orthology | 0.349 | 10 | 128.6 | 3.3e-30 |
| Cs3g27690.1 | orthology | 0.337 | 11 | 131.7 | 2.5e-31 |
| DCAR_023025 | orthology | 0.305 | 4 | - | - |
| HORVU7Hr1G051110.3 | orthology | 1 | 11 | - | - |
| MELO3C017056.2.1 | orthology | 0.483 | 11 | 127.5 | 3.9e-30 |
| Manes.05G127500.1 | orthology | 0.376 | 9 | 129.4 | 1.4e-30 |
| Manes.18G002200.1 | orthology | 0.389 | 9 | - | - |
| Mba08_g25790.1 | orthology | 0.674 | 9 | 106.7 | 9.3e-24 |
| ORGLA08G0178600.1 | orthology | 0.771 | 10 | 103.6 | 7.5e-23 |
| Oeu013567.1 | orthology | 0.301 | 3 | - | - |
| Sspon.06G0001840-1A | orthology | 0.979 | 9 | - | - |
| Sspon.06G0001840-2C | orthology | 0.79 | 9 | - | - |
| Sspon.06G0001840-3D | orthology | 0.8 | 9 | 105.1 | 7.6e-23 |
| XP_010932092.1 | orthology | 0.48 | 8 | 121.7 | 4.4e-28 |
| XP_017697769.1 | orthology | 0.505 | 8 | 121.7 | 4.1e-28 |
| XP_019707878.1 | orthology | 0.518 | 9 | - | - |
| bradi_pan_p007471 | orthology | 0.781 | 10 | 115 | 6.17e-35 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_11445.1 | orthology | 0.492 | 7 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_22304.1 | orthology | 0.49 | 7 | 125.9 | 1.5e-29 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_22894.1 | orthology | 0.488 | 6 | - | - |
| capan_pan_p037558 | orthology | 0.289 | 2 | - | - |
| cicar_pan_p012771 | orthology | 0.61 | 8 | 126 | 1.66e-39 |
| cocnu_pan_p024788 | orthology | 0.48 | 8 | 116 | 1.17e-35 |
| cocnu_pan_p029661 | orthology | 0.544 | 9 | - | - |
| cucsa_pan_p017207 | orthology | 0.483 | 11 | 125 | 2.99e-39 |
| maize_pan_p023740 | orthology | 0.773 | 9 | 104 | 5.76e-31 |
| maldo_pan_p020708 | orthology | 0.373 | 9 | 128 | 4.06e-40 |
| medtr_pan_p031498 | orthology | 0.543 | 8 | 127 | 4e-40 |
| musac_pan_p036492 | orthology | 0.662 | 9 | 105 | 1.79e-31 |
| orysa_pan_p046260 | orthology | 0.747 | 10 | 103 | 1.44e-30 |
| phavu.G19833.gnm2.ann1.Phvul.002G208500.1 | orthology | 0.499 | 6 | 121.7 | 2.5e-28 |
| sorbi_pan_p020199 | orthology | 0.749 | 9 | 105 | 3.33e-31 |
| soybn_pan_p018879 | orthology | 0.542 | 6 | 123 | 3.21e-38 |
| soybn_pan_p037728 | orthology | 0.568 | 7 | - | - |
| soybn_pan_p037999 | orthology | 0.609 | 7 | - | - |
| soybn_pan_p041984 | orthology | 0.578 | 7 | - | - |
| thecc_pan_p004256 | orthology | 0.385 | 10 | - | - |
| tritu_pan_p008810 | orthology | 0.787 | 11 | - | - |
| vitvi_pan_p014910 | orthology | 0.299 | 8 | 135 | 5.08e-43 |
| vitvi_pan_p031077 | orthology | 0.299 | 8 | - | - |