Gene Ca_74_24.3
Sequence ID | Ca_74_24.3 add to my list | ||
---|---|---|---|
Species | Coffea arabica | ||
Alias | No gene alias | ||
Length | 147aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 147 amino acids
>Ca_74_24.3_COFAR MGALDYLSNFCTVTSTRRSKRKPMQTVEIKVKMDCDGCERRVKNAVKDMKGLKTLEVDRK QSRVKVSGYVDPNKVLKRIKDTGKRAEFWPYVPHNLVFYPYVTGAYDKRAPAGFVRNVVQ AAPPPNATEERITYLFSDDNPNACSIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Ca_74_24.3
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Ca_1_37.3 | orthology | 0 | 1 | - | - |
Ca_25_217.3 | orthology | 0 | 1 | - | - |
Ca_53_45.6 | orthology | 0 | 1 | - | - |
Cc07_g08240 | orthology | 0 | 1 | - | - |
DCAR_025878 | orthology | 0.17 | 2 | - | - |
HanXRQChr12g0375901 | orthology | 0.235 | 4 | - | - |
HanXRQChr17g0543461 | orthology | 0.217 | 4 | - | - |
Oeu030808.1 | orthology | 0.234 | 5 | - | - |
Oeu041969.1 | orthology | 0.296 | 5 | - | - |
PGSC0003DMP400053293 | orthology | 0.336 | 7 | - | - |
Solyc02g091300.2.1 | orthology | 0.316 | 7 | - | - |
capan_pan_p020935 | orthology | 0.311 | 6 | - | - |