Gene Ca_84_91.1
Sequence ID | Ca_84_91.1 add to my list | ||
---|---|---|---|
Species | Coffea arabica | ||
Alias | No gene alias | ||
Length | 343aa | ||
Gene Ontology |
![]()
|
Length: 343 amino acids
>Ca_84_91.1_COFAR MKSVELFCASPASTAICSSMDQRSMVRQGGIRRIDHHGHRFGDHHHRHKTRTPIPCSSQI PISPRAYFDKTRKGNSSAKQNLESLRRKSSADISDLSSPPPTGSSRHLLSDTPLLELLSD SEHSSSALVPSQPLRSLKYHKFNESTVFRSSMSSTHSYDNPVYEFSWAGRSNDDLHAYKS SSPRSNNDSSVQNSSTPRKYHDLHARKSSLSRLIHDDFPAQKSSLSRTDTSLSSKSSLTC RNDGHAYKSPSTPGRPRHQIVELRVSIHCKGCEGKIRKHIAKMEGVTSFSTDLATKKVTV IGNVTPLGVLTSVSKVKNAEFWSSPASSSSSSSPTVDMSLVSA
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP015837 | Unannotated cluster |
3 | GP040905 | Unannotated cluster |
4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Ca_84_91.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Cc01_g12180 | orthology | 0.0027 | 1 | 565.5 | 2.1e-161 |
Oeu040283.1 | orthology | 0.536 | 4 | 215.7 | 7.1e-56 |
Oeu058521.1 | orthology | 0.47 | 4 | 233 | 4.72e-75 |
PGSC0003DMP400027269 | orthology | 0.533 | 6 | 209.1 | 4.5e-54 |
Solyc11g073020.1.1 | orthology | 0.529 | 6 | 206.8 | 2.2e-53 |
capan_pan_p010270 | orthology | 0.488 | 5 | 174 | 1.16e-52 |
ipotf_pan_p019321 | orthology | 0.77 | 3 | - | - |
ipotf_pan_p020149 | orthology | 0.649 | 3 | 138 | 1.24e-38 |
itb07g12040.t1 | orthology | 0.754 | 3 | - | - |
itb14g16600.t1 | orthology | 0.634 | 3 | 201.8 | 7.9e-52 |