Gene Ca_88_414.1
| Sequence ID | Ca_88_414.1 add to my list |
|---|---|
| Species | Coffea arabica |
| Alias | No gene alias |
| Length | 170aa |
Length: 170 amino acids
>Ca_88_414.1_COFAR MAGVRTAETELSSGKVTVTGSMDANRLVEYVYRRTKKEAKVVPQPEPAPAEKPKEEALAK PSEGPIKEEKPPAAEGEEAKAPQVEKNPEEAAEKKGPQEEEVEEKKEGGGGESGNNGDAA GGNEAVMMMSNVDELSKQQMMYYYQPLYVMERIPPPQLFSDENPNACCIA
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP126431 | Unannotated cluster |
| 4 | GP077890 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_24_288.1 | orthology | 0 | 1 | - | - |
| Cc02_g00720 | orthology | 0.0158 | 2 | - | - |