Gene Ca_88_414.2


Sequence ID Ca_88_414.2  add to my list
Species Coffea arabica
Alias No gene alias
Length 146aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 146 amino acids

>Ca_88_414.2_COFAR
MANLQIVPAAGITNAVEAQYVEMKVPLYSYGCQKKVKKALAHLKGIYSIIVDCEEQKVTV
WGICNKYDVLASIRNKRKGACFWKPEDNTQLLVPEKLQTPPSSPQSDSCPNPKPTSAPSL
ALVTKGLGRSLSWKTWKKVFIRSYSF




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP342521 Unannotated cluster
4 GP077751 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Ca_88_414.2