Gene Ca_9_475.1
Sequence ID | Ca_9_475.1 add to my list | ||
---|---|---|---|
Species | Coffea arabica | ||
Alias | No gene alias | ||
Length | 175aa | ||
Gene Ontology |
![]()
|
Length: 175 amino acids
>Ca_9_475.1_COFAR MSMKAAKNMRGFMCQSPAATAVCMASEPLSVIVRRGPESDRTLAEHARLIDSTKHSRMVE PRARSRGLASATLRSAIVPSFGVENQPDKASRSQVVSSLAERDQVFQVVVMRVSLHCQGC AGKVKKHLSKMEGVTSFSIDLESKRVTVMGHVSPTGVVESISKVKRAELWPSAPC
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP015837 | Unannotated cluster |
3 | GP040905 | Unannotated cluster |
4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Ca_9_475.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Cc02_g21770 | orthology | 0.0094 | 1 | - | - |
Cg3g006140.1 | orthology | 0.687 | 8 | - | - |
Cm169730.1 | orthology | 0.683 | 8 | - | - |
Cm169730.2.1 | orthology | 0.683 | 8 | - | - |
HanXRQChr11g0336891 | orthology | 0.649 | 3 | - | - |
MELO3C018661.2.1 | orthology | 0.582 | 4 | - | - |
Manes.06G009700.1 | orthology | 0.683 | 5 | - | - |
cajca.ICPL87119.gnm1.ann1.C.cajan_13580.1 | orthology | 0.865 | 3 | - | - |
cucsa_pan_p000289 | orthology | 0.616 | 4 | - | - |
orange1.1t02697.1 | orthology | 0.687 | 8 | - | - |
thecc_pan_p016597 | orthology | 0.588 | 6 | - | - |