Gene Cc01_g19790
| Sequence ID | Cc01_g19790 add to my list | ||
|---|---|---|---|
| Species | Coffea canephora | ||
| Alias | No gene alias | ||
| Length | 137aa | ||
| Gene Annotation | Hypothetical protein | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 137 amino acids
>Cc01_g19790_COFCA MKVVEVLSSISGVYAVEVDAREGLAKVYGEVDPSILLMALSGSGKHAEVAWVRLKHPALS NDCHNSGCHGRYTRRGPSWYDQNGYCHLGQQPFCPRRRAMADHQDPYQCHHGCGGYGYGP YAYPPRADDTAPHCSVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP241299 | Unannotated cluster |
| 3 | GP344409 | Unannotated cluster |
| 4 | GP469723 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cc01_g19790
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_75_14.5 | orthology | 0.0073 | 1 | 300.8 | 1.2e-81 |