Gene Cc02_g08260
Sequence ID | Cc02_g08260 add to my list | ||
---|---|---|---|
Species | Coffea canephora | ||
Alias | No gene alias | ||
Length | 231aa | ||
Gene Annotation | Hypothetical protein | ||
Gene Ontology |
Display term(s) (1)
|
Length: 231 amino acids
>Cc02_g08260_COFCA MNINCCEFCPGRLERALLTIDGVLSVAVYSEKNLVAVKGKVDPNKLIASIKAWGKTAKFL GYDGGPMNFSNQADKEKPQSSKPVRDKCPEHKNFPKNGKERNRGYPKDESRKKEESSHEP EAYVAPQIDREVCRDPYCKLHKCRPIFHNKVPSIDCADHPHHTGGYFPKGGSGSHFLNHG NASPYDYPRMAPHPMMEQPGYGFYSGSYYGPRFDDYSYHDDAPYPRHWPYM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP241502 | Unannotated cluster |
3 | GP344090 | Unannotated cluster |
4 | GP467269 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cc02_g08260
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Ca_9_295.1 | orthology | 0.022 | 1 | 485 | 7.3e-137 |
HanXRQChr09g0250511 | orthology | 1 | 3 | - | - |
HanXRQChr16g0528781 | orthology | 1 | 3 | - | - |
maize_pan_p014797 | orthology | 1 | 3 | - | - |
maize_pan_p023480 | orthology | 1 | 3 | - | - |
sorbi_pan_p012760 | orthology | 1 | 3 | - | - |
sorbi_pan_p027660 | orthology | 1 | 3 | - | - |
tritu_pan_p007910 | orthology | 1 | 2 | - | - |