Gene Cc02_g14880


Sequence ID Cc02_g14880  add to my list
Species Coffea canephora
Alias No gene alias
Length 138aa
Gene Annotation Heavy metal transport/detoxification superfamily protein
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 138 amino acids

>Cc02_g14880_COFCA
MRVHMDCPGCESKIKKALRKLDGVDNVDVDMGMQKVTVTGYADQEKVLKTVRKTGRLAEL
WPFPYNPEYHDFNYAYYNHYYRNPATNFSYSFSSYNYEVHGYNGHDHGYYHKPPFSTVID
DRTRYMFSDENAHGCSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP078604 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Cc02_g14880



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Ca_24_186.3 orthology 0.023 1 231.5 8.7e-61
Ca_42_221.2 orthology 0.023 2 - -
Ca_66_295.2 orthology 0.023 2 - -
Oeu043106.1 orthology 0.502 3 148.7 4.3e-36
PGSC0003DMP400018109 orthology 0.419 4 110.9 6.8e-25
Solyc02g076880.2.1 orthology 0.442 4 167.2 8e-42
capan_pan_p000797 orthology 0.427 3 166 3.58e-54
ipotf_pan_p011098 orthology 0.431 5 122 3.97e-37
itb10g02670.t1 orthology 0.405 5 154.1 7.6e-38