Gene Cc02_g26130
Sequence ID | Cc02_g26130 add to my list | ||
---|---|---|---|
Species | Coffea canephora | ||
Alias | No gene alias | ||
Length | 236aa | ||
Gene Annotation | Heavy metal transport/detoxification superfamily protein | ||
Gene Ontology |
![]()
|
Length: 236 amino acids
>Cc02_g26130_COFCA MSKEEKKEKEKVKVKEKEIEVITAVYKINLHCPKCAHDIRRPLLRIPGVHSADIKHEKNE VTIKGAIVAKKMHERLQKWSKKKVELISETKVKEAEKGAKETKKTILIKSYMHCAECERE IRKRLLKHKGIHNVKTDIKAQTISIEGVIESEKLLTYMRKKVHKYAEIIPPKAKEKEKEK KDEKKEKEKIEVKIVEFKEVEKVAAKTKEGDTPYFVHYVYAPQLFSDENPNACSIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP342504 | Unannotated cluster |
4 | GP464372 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cc02_g26130
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Ca_64_447.2 | orthology | 0.0011 | 1 | 348.2 | 1.1e-95 |
DCAR_029550 | orthology | 0.517 | 4 | 252.3 | 3.4e-67 |
HanXRQChr06g0168381 | orthology | 0.596 | 5 | 195.7 | 5.4e-50 |
Oeu036922.1 | orthology | 0.28 | 2 | - | - |
PGSC0003DMP400011529 | orthology | 0.507 | 6 | 218.8 | 3.9e-57 |
Solyc10g039390.1.1 | orthology | 0.56 | 6 | 232.3 | 3.4e-61 |
capan_pan_p023451 | orthology | 0.534 | 5 | 153 | 1.08e-47 |
ipotf_pan_p011107 | orthology | 0.466 | 5 | 231 | 8.81e-77 |
itb09g19040.t1 | orthology | 0.489 | 5 | 145.2 | 6e-35 |