Gene Cc03_g01320
| Sequence ID | Cc03_g01320 add to my list | ||
|---|---|---|---|
| Species | Coffea canephora | ||
| Alias | No gene alias | ||
| Length | 286aa | ||
| Gene Annotation | Putative uncharacterized protein | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 286 amino acids
>Cc03_g01320_COFCA MQKPRVTEIQVRMDCNGCVQKIKKALLGISGVYELYIDFPQQKITIIGCADPEKIVKAIK KTRKTAIICSHTEPQAQPSDPDNQGEAPPQESANPPQQESATPPPSEGPPTEEASPAEAP PAEAPKDPPPPAESPKPDAAEAPASKPVQSSGPKDVEEVHVIYHHPPDFGYRYGYNPSMS SPNMGQGYISGYWHSYPTGPVFRPEPPAPVPAPPPPPTYVTHSYNTHRASPYVTGYEYTR PPPQYSHYTRPESYQQPQEDYHYGNNGNGNITSVFSDENPNACRIV
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP047778 | Unannotated cluster |
| 4 | GP077656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cc03_g01320
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_30_103.2 | orthology | 0.0059 | 2 | 384 | 2.2e-106 |
| Ca_5_216.1 | orthology | 0.0059 | 2 | - | - |
| Ca_71_41.4 | orthology | 0.0059 | 2 | - | - |
| Oeu016262.1 | orthology | 0.522 | 2 | - | - |