Gene Cc04_g13830
| Sequence ID | Cc04_g13830 add to my list | ||
|---|---|---|---|
| Species | Coffea canephora | ||
| Alias | No gene alias | ||
| Length | 209aa | ||
| Gene Annotation | Putative uncharacterized protein | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 209 amino acids
>Cc04_g13830_COFCA MDKRAPDPIIILKVDTNCCDDCSGKLEKALLEINGVNQAIVDPQKKSVSIRGNANSCMLI EEIARMGKRAELMFYDKEPKVEGHHQKNVRFAQEKHPSTDDHHKQNVRQDDGHKHFCCDD HDDGGEENMPSWGSKNIFGSHSDYPRQTHFCPESSRHDTRNPNYSRWFREEPPPYDHPRW RMSPPPPSSYFYGPFRGRRPMSQFDHFPH
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP241502 | Unannotated cluster |
| 3 | GP344090 | Unannotated cluster |
| 4 | GP467269 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cc04_g13830
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_74_94.1 | orthology | 0 | 1 | 400.6 | 1.6e-111 |
| HanXRQChr09g0250511 | orthology | 1 | 3 | - | - |
| HanXRQChr16g0528781 | orthology | 1 | 3 | - | - |
| maize_pan_p014797 | orthology | 1 | 3 | - | - |
| maize_pan_p023480 | orthology | 1 | 3 | - | - |
| sorbi_pan_p012760 | orthology | 1 | 3 | - | - |
| sorbi_pan_p027660 | orthology | 1 | 3 | - | - |
| tritu_pan_p007910 | orthology | 1 | 2 | - | - |