Gene Cc05_g08310
Sequence ID | Cc05_g08310 add to my list | ||
---|---|---|---|
Species | Coffea canephora | ||
Alias | No gene alias | ||
Length | 153aa | ||
Gene Annotation | Heavy metal transport/detoxification superfamily protein | ||
Gene Ontology |
![]()
|
Length: 153 amino acids
>Cc05_g08310_COFCA MLVHMDCAGCVSKIRKALQNLKGVDNVEIDMSMQKVTVTGSVEQKKVLKTVRKTGRRAEL WQLPYNPVLRNHNYTVYNPHSYGGCGGPATYYATSQPPAASSYNYYKHGYDHSSQDYGYF SSYSSHQFGHSTIFGSRVGEVFSEESVHGCSIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cc05_g08310
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Oeu042935.1 | orthology | 0.529 | 2 | 179.5 | 2.5e-45 |
PGSC0003DMP400035470 | orthology | 0.647 | 5 | 119.8 | 1.6e-27 |
Solyc07g055010.2.1 | orthology | 0.658 | 5 | 173.7 | 9.4e-44 |
capan_pan_p019104 | orthology | 0.65 | 4 | 177 | 4.99e-58 |
ipotf_pan_p020842 | orthology | 0.556 | 4 | 174 | 7.28e-57 |
itb02g08570.t1 | orthology | 0.562 | 4 | 171.8 | 3.9e-43 |