Gene Cc07_g15640


Sequence ID Cc07_g15640  add to my list
Species Coffea canephora
Alias No gene alias
Length 151aa
Gene Annotation Heavy metal-associated isoprenylated plant protein 26
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 151 amino acids

>Cc07_g15640_COFCA
MGVSGTLEYLSDLVSSGHKHKKKKQMQTVELKVRMDCEGCELKVKKALSSLSGVKTVEIN
RKLQKATVTGYVEPNKVLKKAKSTGKKAEIWPYVPYGLVAQPYAVQSYDKKAPPGYVRKV
EYPTTGTVTRYDQDPYISMFSDENPNACSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463617 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Cc07_g15640



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Ca_15_106.6 orthology 0.0136 1 302.4 4.4e-82
cicar_pan_p015624 orthology 0.16 3 252 1.17e-87
medtr_pan_p029264 orthology 0.165 3 248 5.45e-86
vitvi_pan_p020609 orthology 0.184 3 254 1.19e-88