Gene Cc09_g00430
| Sequence ID | Cc09_g00430 add to my list | ||
|---|---|---|---|
| Species | Coffea canephora | ||
| Alias | No gene alias | ||
| Length | 217aa | ||
| Gene Annotation | Putative Heavy metal transport/detoxification superfamily protein | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 217 amino acids
>Cc09_g00430_COFCA MDGNGNTFTFYTGVESVTADCKGSKVVVKGKSADPVKVCERIHRKSGRKVELISPLPKPL EEAPKAPVEEKKMEEPPAVITVVLNVQMHCEACAQVLQKRIRKVQGVESVTTDVANNQVV VKGVVDPEKLVTDVYKRTRKQASIVKDEAKKEDEKKDDVKTEVKENEKKESEEGKEGDDV KTDAKKSEYWPQRYYYMEYAYPSLMFSDENPHACTVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cc09_g00430
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_32_762.1 | orthology | 0.0114 | 1 | - | - |
| Ca_69_1.19 | orthology | 0.0114 | 1 | - | - |
| Cg2g046420.1 | orthology | 0.648 | 9 | 151.8 | 4.9e-37 |
| Cm145580.1 | orthology | 0.865 | 8 | 114 | 3.7e-32 |
| Cm298860.1 | orthology | 0.654 | 8 | - | - |
| Cs2g01750.1 | orthology | 0.648 | 9 | 151.8 | 5.3e-37 |
| DCAR_002239 | orthology | 0.524 | 5 | 167.9 | 7.8e-42 |
| DCAR_030843 | orthology | 0.567 | 5 | - | - |
| FvH4_3g00420.1 | orthology | 0.613 | 9 | 147.5 | 9.6e-36 |
| HanXRQChr16g0515801 | orthology | 0.667 | 5 | 165 | 1.31e-50 |
| MELO3C008010.2.1 | orthology | 0.755 | 8 | 139.8 | 1.7e-33 |
| Manes.09G082500.1 | orthology | 0.802 | 8 | - | - |
| Manes.S022000.1 | orthology | 0.575 | 8 | 168.3 | 6e-42 |
| Oeu029318.1 | orthology | 0.45 | 4 | 172.6 | 4.3e-43 |
| Oeu057024.1 | orthology | 0.488 | 4 | - | - |
| PGSC0003DMP400023518 | orthology | 0.73 | 5 | - | - |
| PGSC0003DMP400026383 | orthology | 0.495 | 4 | 162.2 | 4e-40 |
| Solyc04g015030.2.1 | orthology | 0.503 | 4 | 161.4 | 6.9e-40 |
| Solyc11g012690.1.1 | orthology | 0.779 | 5 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_16695.1 | orthology | 0.624 | 7 | 179 | 1.16e-56 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_24624.1 | orthology | 0.561 | 7 | 147.5 | 1.1e-35 |
| capan_pan_p012494 | orthology | 0.632 | 3 | 130 | 1.65e-38 |
| capan_pan_p018045 | orthology | 0.745 | 4 | - | - |
| cicar_pan_p024449 | orthology | 0.581 | 6 | 184 | 3.02e-58 |
| cucsa_pan_p011686 | orthology | 0.744 | 8 | 165 | 1.47e-50 |
| ipotf_pan_p000797 | orthology | 0.517 | 4 | 184 | 5.59e-58 |
| itb01g10210.t2 | orthology | 0.523 | 4 | 151.8 | 5.9e-37 |
| maldo_pan_p012376 | orthology | 0.625 | 9 | - | - |
| maldo_pan_p020510 | orthology | 0.635 | 9 | 192 | 2.47e-61 |
| medtr_pan_p010658 | orthology | 0.566 | 6 | 182 | 2.4e-57 |
| phavu.G19833.gnm2.ann1.Phvul.003G086400.1 | orthology | 0.575 | 7 | 148.3 | 5.8e-36 |
| phavu.G19833.gnm2.ann1.Phvul.006G139700.1 | orthology | 0.612 | 7 | - | - |
| soybn_pan_p008938 | orthology | 0.555 | 6 | 185 | 1.45e-58 |
| soybn_pan_p009673 | orthology | 0.587 | 6 | - | - |
| soybn_pan_p024238 | orthology | 0.569 | 6 | - | - |
| thecc_pan_p018912 | orthology | 0.543 | 8 | 184 | 5.36e-58 |
| vitvi_pan_p012828 | orthology | 0.603 | 7 | 180 | 1.66e-56 |