Gene Cc11_g10300
| Sequence ID | Cc11_g10300 add to my list | ||
|---|---|---|---|
| Species | Coffea canephora | ||
| Alias | No gene alias | ||
| Length | 96aa | ||
| Gene Annotation | Copper transport protein family | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 96 amino acids
>Cc11_g10300_COFCA MVMKISLDCNGCCRKMRRIILRMKEIETHSIEKQHSRVIVCGRFVPADIAIKIRKKMKRR VEILEIEGLSSGSDGHTEQEPAPTHVPDPHAIAQHA
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP109350 | Unannotated cluster |
| 3 | GP119142 | Unannotated cluster |
| 4 | GP077996 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cc11_g10300
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_3_44.3 | orthology | 0.031 | 1 | 183.7 | 1.5e-46 |
| Ca_62_10.3 | orthology | 0.0133 | 1 | - | - |
| Ca_66_11.1 | orthology | 0.0142 | 1 | 184 | 6.54e-62 |
| Oeu008040.1 | orthology | 0.685 | 2 | - | - |