Gene Cg2g008690.1


Sequence ID Cg2g008690.1  add to my list
Species Citrus maxima
Alias No gene alias
Length 137aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 137 amino acids

>Cg2g008690.1_CITMA
MRVHMDCAGCESKVKSSLNKLKGVDDIDIDMAMQKVTVTGWADQKKVLKAVRKTGRRAEL
WQLPYSPAEQHGYYNQHQCNGPVTHYAHQPSSSYNYYKHGYDSQNHAYYHYPAVASIFSN
QTGSTFSDENPHACSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP078604 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Cg2g008690.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
AT1G06330.1 orthology 0.555 6 194.9 3.3e-50
FvH4_6g27360.1 orthology 0.538 5 188 4e-48
MELO3C018725.2.1 orthology 0.615 6 177.9 3.6e-45
Manes.15G048400.1 orthology 0.35 4 220.7 6.5e-58
brana_pan_p013116 orthology 0.532 7 191 1.3e-63
braol_pan_p024201 orthology 0.532 7 191 1.18e-63
brarr_pan_p028890 orthology 0.532 7 191 1.05e-63
cajca.ICPL87119.gnm1.ann1.C.cajan_23872.1 orthology 0.482 7 211.1 5.1e-55
cucsa_pan_p019751 orthology 0.607 6 176 4.8e-58
medtr_pan_p000903 orthology 0.516 5 214 3.89e-73
phavu.G19833.gnm2.ann1.Phvul.005G095400.1 orthology 0.489 6 212.6 1.6e-55
soybn_pan_p032804 orthology 0.483 7 214 9.34e-73
thecc_pan_p014674 orthology 0.252 1 177 1.39e-58
vitvi_pan_p026446 orthology 0.474 5 212 3.34e-72