Gene Cg2g033970.1
Sequence ID | Cg2g033970.1 add to my list | ||
---|---|---|---|
Species | Citrus maxima | ||
Alias | No gene alias | ||
Length | 146aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 146 amino acids
>Cg2g033970.1_CITMA MGVLDHLFDLFETTPRGKKRKPMQTVDIKVKMDCDGCERKVRNAVSSIRGAKSVEVNRKQ SRVTVTGYVDPNKVLKKVKSTGKRAEFWPYVPYNLVAYPYVAQAYDKKAPSGYVKNVVQA LPSPNATDERLTTLFSDENPNACSIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cg2g033970.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Cm053250.1 | orthology | 0.0147 | 2 | 294.7 | 5.3e-80 |
Cs2g13790.1 | orthology | 0.0079 | 2 | 297 | 6.9e-81 |
MELO3C005315.2.1 | orthology | 0.531 | 5 | - | - |
MELO3C012307.2.1 | orthology | 0.471 | 5 | 232.6 | 1.3e-61 |
Manes.15G126400.1 | orthology | 0.256 | 3 | 251.5 | 3.6e-67 |
Manes.17G075300.1 | orthology | 0.31 | 3 | - | - |
cucsa_pan_p007548 | orthology | 0.525 | 5 | - | - |
cucsa_pan_p020835 | orthology | 0.478 | 5 | 226 | 1.21e-77 |
thecc_pan_p004875 | orthology | 0.222 | 2 | 244 | 1.04e-84 |