Gene Cg2g046420.1
| Sequence ID | Cg2g046420.1 add to my list | ||
|---|---|---|---|
| Species | Citrus maxima | ||
| Alias | No gene alias | ||
| Length | 225aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 225 amino acids
>Cg2g046420.1_CITMA MHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVCERLQKKSGRKVELIS PLPKPPPPDADDQEKKEQQKVEKKEEPPAAITVVLNVRMHCEACAQGLRKRIRKIQGVEC VETNLASGQVIVKGVVDPVKLVNDVNKKTRKQASIVKDEEKKQEEKKEGEKKDGGEEAKV DEEKNKQQLDFNINRSEYWATKNYSEFAYAPQIFSDENPNACFVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cg2g046420.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_14_162.1 | orthology | 0.589 | 9 | 191 | 2.1e-48 |
| Ca_32_762.1 | orthology | 0.653 | 9 | - | - |
| Ca_69_1.19 | orthology | 0.653 | 9 | - | - |
| Ca_78_26.1 | orthology | 0.589 | 9 | - | - |
| Ca_9_645.2 | orthology | 0.649 | 8 | - | - |
| Cc09_g00430 | orthology | 0.648 | 9 | 157.9 | 6.7e-39 |
| Cs2g01750.1 | orthology | 0.0011 | 1 | 318.9 | 2.6e-87 |
| DCAR_002239 | orthology | 0.545 | 9 | 192.2 | 4e-49 |
| DCAR_030843 | orthology | 0.587 | 9 | - | - |
| FvH4_3g00420.1 | orthology | 0.404 | 7 | 190.7 | 1e-48 |
| HanXRQChr16g0515801 | orthology | 0.688 | 9 | 183.7 | 2e-46 |
| MELO3C008010.2.1 | orthology | 0.497 | 4 | 203 | 1.7e-52 |
| Manes.09G082500.1 | orthology | 0.512 | 2 | - | - |
| Manes.S022000.1 | orthology | 0.286 | 2 | 194.5 | 8.1e-50 |
| Oeu029318.1 | orthology | 0.47 | 8 | - | - |
| Oeu057024.1 | orthology | 0.508 | 8 | 216.9 | 2.1e-56 |
| PGSC0003DMP400023518 | orthology | 0.802 | 11 | - | - |
| PGSC0003DMP400026383 | orthology | 0.567 | 10 | 201.4 | 6.2e-52 |
| Solyc04g015030.2.1 | orthology | 0.574 | 10 | 205.7 | 3.3e-53 |
| Solyc11g012690.1.1 | orthology | 0.851 | 11 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_16695.1 | orthology | 0.463 | 7 | 210.3 | 1.4e-54 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_24624.1 | orthology | 0.4 | 7 | 236 | 6.7e-79 |
| capan_pan_p012494 | orthology | 0.704 | 9 | - | - |
| capan_pan_p018045 | orthology | 0.817 | 10 | - | - |
| cicar_pan_p024449 | orthology | 0.42 | 6 | 219 | 5.2e-72 |
| cucsa_pan_p011686 | orthology | 0.485 | 4 | 211 | 1.77e-68 |
| ipotf_pan_p000797 | orthology | 0.589 | 10 | 207 | 6.62e-67 |
| itb01g10210.t2 | orthology | 0.595 | 10 | 192.2 | 4.1e-49 |
| maldo_pan_p012376 | orthology | 0.417 | 7 | 239 | 1.89e-79 |
| maldo_pan_p020510 | orthology | 0.426 | 7 | - | - |
| medtr_pan_p010658 | orthology | 0.406 | 6 | 229 | 8.46e-76 |
| phavu.G19833.gnm2.ann1.Phvul.003G086400.1 | orthology | 0.414 | 7 | 218.4 | 4.7e-57 |
| phavu.G19833.gnm2.ann1.Phvul.006G139700.1 | orthology | 0.451 | 7 | - | - |
| soybn_pan_p008938 | orthology | 0.395 | 6 | 240 | 6.56e-80 |
| soybn_pan_p009673 | orthology | 0.427 | 6 | - | - |
| soybn_pan_p024238 | orthology | 0.408 | 6 | - | - |
| thecc_pan_p018912 | orthology | 0.335 | 6 | 231 | 3.93e-76 |
| vitvi_pan_p012828 | orthology | 0.395 | 5 | 236 | 1.37e-78 |