Gene Cg3g015470.1
Sequence ID | Cg3g015470.1 add to my list | ||
---|---|---|---|
Species | Citrus maxima | ||
Alias | No gene alias | ||
Length | 150aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 150 amino acids
>Cg3g015470.1_CITMA MGVEGTIEYISDLLSSVKKKKKKKQMQTVALKVRMDCDGCARKMKGVLSSVKGAKSVDVD LKQQKVTVTGFVEPKKVLAAAKATKKKVEIWPYVPYNIVSNPYVSQAYDKKAPPNHVRAI PATATVTESTMDDRYTNMFSDENPNACSIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cg3g015470.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT4G08570.1 | orthology | 0.374 | 6 | 204.9 | 3.5e-53 |
Cm020980.1 | orthology | 0.0131 | 2 | 270 | 1.4e-72 |
Cs3g18690.1 | orthology | 0 | 1 | 274.2 | 4.9e-74 |
Manes.18G070700.1 | orthology | 0.208 | 4 | 241.5 | 3.9e-64 |
brana_pan_p007268 | orthology | 0.448 | 7 | - | - |
braol_pan_p017356 | orthology | 0.448 | 7 | - | - |
brarr_pan_p027720 | orthology | 0.4 | 6 | 191 | 9.43e-64 |
thecc_pan_p011528 | orthology | 0.205 | 3 | 241 | 1.38e-83 |