Gene Cg4g020120.1


Sequence ID Cg4g020120.1  add to my list
Species Citrus maxima
Alias No gene alias
Length 127aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 127 amino acids

>Cg4g020120.1_CITMA
MEVVWSPYWFPFVVQLKVRLHCKACEKAVRQALCRITGVKCVEIDTVSNKITVLGYMDRR
VVIKAVQRTGRRAELLSSSSSSSSYYGLEEQSPRLPRGFRCIIPRCGFRSYLRNNNSNVS
GALPPKK




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP481287 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Cg4g020120.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Cc06_g23640 orthology 0.868 4 89.7 1.3e-18
Cs4g04870.1 orthology 0.001 1 201.8 2.6e-52
cucsa_pan_p011897 orthology 0.661 2 100 9.22e-29
thecc_pan_p023685 orthology 0.581 3 113 8.4e-34
vitvi_pan_p042652 orthology 1 5 - -