Gene Cg5g037020.1
Sequence ID | Cg5g037020.1 add to my list | ||
---|---|---|---|
Species | Citrus maxima | ||
Alias | No gene alias | ||
Length | 286aa | ||
Gene Ontology |
![]()
|
Length: 286 amino acids
>Cg5g037020.1_CITMA MAAKLADDQPPHPHPLQFQTWVLKVLIHCEGCKKKVTKILKGIEGVYTAVIDSQQHKVTV IGNVDAETLIKKLLRSGKHAELWPEKKDKTSGKSKNNDKQKELSKDGQEVLDDRHKDTAE KPDEKSGDNPPGTGIEGQGGNGSGGKKKKKKKGNSSGNGGSGENVGNEPAAGITGSPAVA AAVDPIPSKAAPIPRHQQQYPSPPFMQQEHPPMYYPPHPAPLHGVSYNTTYPTASTSYYA PSMHAYYNSSYHRPGRYIPPDPIHKFTEDDHGYYDNDEGTAGCSIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP023608 | Unannotated cluster |
3 | GP040483 | Unannotated cluster |
4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cg5g037020.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Cm177940.1 | orthology | 0.0121 | 2 | 487.6 | 8.3e-138 |
Cs5g32830.1 | orthology | 0.0121 | 2 | 497.3 | 6.8e-141 |
FvH4_2g25240.1 | orthology | 1 | 7 | 111.3 | 1e-24 |
FvH4_3g05420.1 | orthology | 1 | 7 | - | - |
Manes.01G216400.1 | orthology | 0.926 | 5 | 147.9 | 1.1e-35 |
Manes.05G064600.1 | orthology | 0.998 | 5 | - | - |
cajca.ICPL87119.gnm1.ann1.C.cajan_10299.1 | orthology | 0.953 | 4 | 120.6 | 1.9e-27 |
cicar_pan_p013771 | orthology | 0.988 | 4 | 119 | 7.83e-32 |
maldo_pan_p006711 | orthology | 0.996 | 7 | 125 | 1.95e-33 |
maldo_pan_p033280 | orthology | 0.965 | 7 | - | - |
medtr_pan_p025269 | orthology | 1 | 4 | 136 | 3.06e-38 |
phavu.G19833.gnm2.ann1.Phvul.001G205300.1 | orthology | 1 | 5 | 120.6 | 1.7e-27 |
soybn_pan_p005697 | orthology | 0.958 | 5 | - | - |
soybn_pan_p010098 | orthology | 0.982 | 5 | 121 | 5.25e-32 |
thecc_pan_p017549 | orthology | 0.529 | 2 | 158 | 2.11e-46 |
vitvi_pan_p002541 | orthology | 0.921 | 6 | 140 | 2.68e-40 |