Gene Cg5g044990.1
| Sequence ID | Cg5g044990.1 add to my list | ||
|---|---|---|---|
| Species | Citrus maxima | ||
| Alias | No gene alias | ||
| Length | 231aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 231 amino acids
>Cg5g044990.1_CITMA MAAKNKDIGVITGVYNVNLHCPQCARKIEKRLLKIEGIQSVDADFEKAEIKVKGVIDVIK IHKLIQKTSQKKVELISPPLIKIKEIGAIKEIKEQEVILRTTTLKVHIHCAQCEHDLRKK LLKHKGIYSVNADTKAQTVTVQGTIESDRLLSYLRKKVHKHAEIVTSKQEKKEEIKKDNE KFEVKSTELSTKFVEFKEDVKSKESNVPYFIHYVYGPQLFSDENPNACSIL
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP342504 | Unannotated cluster |
| 4 | GP464372 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cg5g044990.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cm175060.1 | orthology | 0.0331 | 2 | 425.6 | 3.1e-119 |
| Cs1g02630.1 | orthology | 0.0087 | 1 | 442.6 | 1.6e-124 |
| thecc_pan_p018185 | orthology | 0.384 | 3 | 266 | 9.49e-91 |