Gene Cg6g011520.1


Sequence ID Cg6g011520.1  add to my list
Species Citrus maxima
Alias No gene alias
Length 148aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 148 amino acids

>Cg6g011520.1_CITMA
MFGWRLGKTQLPNAMAIVELMVHMDCEGCQKRIRRAISKIDGVDSLDIDMDKQKVTVTGY
VDERKVLKVVRRTGRKAEFWPFPYDSEYYPYASTYLDESTFRSSYNYYQHGFNESVHGYF
PDQAYETVPDDTVHLFSEDNVHAYCTIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP078604 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Cg6g011520.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
AT3G56891.1 orthology 0.758 8 165.6 2.3e-41
Ca_28_123.1 orthology 0.577 9 - -
Ca_31_155.3 orthology 0.533 9 - -
Ca_64_676.1 orthology 0.494 9 - -
Ca_78_1273.1 orthology 0.533 9 - -
Cc06_g21060 orthology 0.448 9 121.7 3.5e-28
Cs6g10930.1 orthology 0.0072 1 303.9 5.7e-83
DCAR_016949 orthology 0.594 9 140 6.24e-44
FvH4_2g26780.1 orthology 0.264 5 201.4 3.8e-52
MELO3C019416.2.1 orthology 0.308 5 179.1 1.8e-45
Manes.08G099200.1 orthology 0.256 5 195.3 3.1e-50
Oeu053981.1 orthology 0.515 10 164.1 1.1e-40
brana_pan_p032952 orthology 0.907 9 - -
brana_pan_p033418 orthology 0.877 10 157 7.22e-50
brana_pan_p049288 orthology 0.906 8 - -
braol_pan_p001934 orthology 0.911 9 156 1.36e-49
braol_pan_p038031 orthology 0.854 9 - -
brarr_pan_p006813 orthology 0.877 10 - -
brarr_pan_p018750 orthology 0.91 8 156 1.66e-49
cajca.ICPL87119.gnm1.ann1.C.cajan_46944.1 orthology 0.3 5 197.6 6.3e-51
cucsa_pan_p011351 orthology 0.341 5 230 3.93e-79
ipotf_pan_p003030 orthology 0.674 11 196 1.32e-65
itb11g01700.t1 orthology 0.67 11 194.9 4.2e-50
maldo_pan_p024328 orthology 0.348 5 - -
maldo_pan_p038662 orthology 0.254 5 198 3.55e-66
medtr_pan_p030129 orthology 0.251 3 190 8.46e-64
phavu.G19833.gnm2.ann1.Phvul.004G052700.1 orthology 0.298 4 243.4 9e-65
soybn_pan_p020075 orthology 0.317 5 189 2.38e-63
thecc_pan_p019791 orthology 0.182 4 213 3.3e-72
vitvi_pan_p003255 orthology 0.305 7 177 2.76e-58